PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_01004.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family M-type_MADS
Protein Properties Length: 174aa    MW: 19849.6 Da    PI: 9.0371
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_01004.1_g00008.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.17.2e-111453443
                             -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                   SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                             +nk+  +   sk ++ ++K A  LS+LC++++a+iifs +
  Sme2.5_01004.1_g00008.1 14 KNKRAETAKISKMQKSLFKRADQLSILCGIQIAIIIFSVD 53
                             677777888999*************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006611.437363IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.76E-13882IPR002100Transcription factor, MADS-box
PfamPF003191.2E-91555IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MESQSSNVDL ALTKNKRAET AKISKMQKSL FKRADQLSIL CGIQIAIIIF SVDRQPILFG  60
KPDVESVVHQ FREASDLTAP RFYMKMKKKD GENKEREKSI EDDNTQRLSG DFESPYLESL  120
LNLHRQLKDF EDQLIKETDL TQLNQEIKKH KDSKSVSKMN VASSSTLPTN MASP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015055398.13e-69PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLK4CYJ74e-66K4CYJ7_SOLLC; Uncharacterized protein
TrEMBLM1BPI56e-66M1BPI5_SOLTU; Uncharacterized protein
STRINGSolyc10g012200.1.11e-65(Solanum lycopersicum)
STRINGPGSC0003DMT4000499042e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22971258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-11AGAMOUS-like 62